Solution structure of the ph domain of human calcium-dependent activator protein for secretion (caps)
PDB DOI: 10.2210/pdb1wi1/pdb
Classification: ENDOCYTOSIS/EXOCYTOSIS Organism(s): Homo Sapiens
Deposited: 2004-05-28 Deposition Author(s): Inoue, M. , Izumi, K. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Tochio, N. , Yokoyama, S. , Yoneyama, M. , Yoshida, M.
Solution structure of the ph domain of human calcium-dependent activator protein for secretion (caps)
Inoue, M. , Izumi, K. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Tochio, N. , Yokoyama, S. , Yoneyama, M. , Yoshida, M.
Primary Citation of Related Structures: 1WI1
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| calcium-dependent activator protein for secretion, CAPS | A | 126 | Homo Sapiens | GSSGSSGMKHSGYLWAIGKNVWKRWKKRFFVLVQVSQYTFAMCSYREKKAEPQELLQLDGYTVDYTDPQPGLEGGRAFFNAVKEGDTVIFASDDEQDRILWVQAMYRATGQSHKPVPPTQSGPSSG |
Method: SOLUTION NMR
Deposited Date: 2004-05-28 Deposition Author(s): Inoue, M. , Izumi, K. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Tochio, N. , Yokoyama, S. , Yoneyama, M. , Yoshida, M.