Solution structure of the second rna binding domain from hypothetical protein bab23448
PDB DOI: 10.2210/pdb1whx/pdb
Classification: RNA BINDING PROTEIN Organism(s): Mus Musculus
Deposited: 2004-05-28 Deposition Author(s): Inoue, M. , Kigawa, T. , Muto, Y. , Nagata, T. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Terada, T. , Yokoyama, S.
Solution structure of the second rna binding domain from hypothetical protein bab23448
Inoue, M. , Kigawa, T. , Muto, Y. , Nagata, T. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Terada, T. , Yokoyama, S.
Primary Citation of Related Structures: 1WHX
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| hypothetical protein RIKEN CDNA 1200009A02 | A | 111 | Mus Musculus | GSSGSSGRSKTVILAKNLPAGTLAAEIQETFSRFGSLGRVLLPEGGITAIVEFLEPLEARKAFRHLAYSKFHHVPLYLEWAPIGVFGAAPQKKDSQHEQPAEKAESGPSSG |
Method: SOLUTION NMR
Deposited Date: 2004-05-28 Deposition Author(s): Inoue, M. , Kigawa, T. , Muto, Y. , Nagata, T. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Terada, T. , Yokoyama, S.