Solution structure of the alpha-helical domain from mouse hypothetical pnpase
PDB DOI: 10.2210/pdb1whu/pdb
Classification: TRANSFERASE Organism(s): Mus Musculus
Deposited: 2004-05-28 Deposition Author(s): Inoue, M. , Kigawa, T. , Muto, Y. , Nagata, T. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Terada, T. , Yokoyama, S.
Solution structure of the alpha-helical domain from mouse hypothetical pnpase
Inoue, M. , Kigawa, T. , Muto, Y. , Nagata, T. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Terada, T. , Yokoyama, S.
Primary Citation of Related Structures: 1WHU
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| polynucleotide phosphorylase; 3'-5' RNA exonuclease | A | 104 | Mus Musculus | GSSGSSGPQKIFTPSAEIVKYTKIIAMEKLYAVFTDYEHDKVSRDEAVNKIRLDTEEHLKEKFPEVDQFEIIESFNIVAKEVFRSIILNEYKRCDGRDSGPSSG |
Method: SOLUTION NMR
Deposited Date: 2004-05-28 Deposition Author(s): Inoue, M. , Kigawa, T. , Muto, Y. , Nagata, T. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Terada, T. , Yokoyama, S.