Solution structure of the n-terminal dsrbd from hypothetical protein bab28848
PDB DOI: 10.2210/pdb1whq/pdb
Classification: RNA BINDING PROTEIN Organism(s): Mus Musculus
Deposited: 2004-05-28 Deposition Author(s): Inoue, M. , Kigawa, T. , Muto, Y. , Nagata, T. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Terada, T. , Yokoyama, S.
Solution structure of the n-terminal dsrbd from hypothetical protein bab28848
Inoue, M. , Kigawa, T. , Muto, Y. , Nagata, T. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Terada, T. , Yokoyama, S.
Primary Citation of Related Structures: 1WHQ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| RNA helicase A | A | 99 | Mus Musculus | GSSGSSGIKNFLYAWCGKRKMTPAYEIRAVGNKNRQKFMCEVRVEGFNYAGMGNSTNKKDAQSNAARDFVNYLVRINEVKSEEVPAVGIVPPPSGPSSG |
Method: SOLUTION NMR
Deposited Date: 2004-05-28 Deposition Author(s): Inoue, M. , Kigawa, T. , Muto, Y. , Nagata, T. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Terada, T. , Yokoyama, S.