Solution structure of the 1st cap-gly domain in human cylindromatosis tumor suppressor cyld
PDB DOI: 10.2210/pdb1whl/pdb
Classification: ANTITUMOR PROTEIN Organism(s): Homo Sapiens
Deposited: 2004-05-28 Deposition Author(s): Inoue, M. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Saito, K. , Yokoyama, S.
Solution structure of the 1st cap-gly domain in human cylindromatosis tumor suppressor cyld
Inoue, M. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Saito, K. , Yokoyama, S.
Primary Citation of Related Structures: 1WHL
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Cylindromatosis tumor suppressor CYLD | A | 95 | Homo Sapiens | GSSGSSGIDVGCPVKVQLRSGEEKFPGVVRFRGPLLAERTVSGIFFGVELLEEGRGQGFTDGVYQGKQLFQCDEDCGVFVALDKLELIESGPSSG |
Method: SOLUTION NMR
Deposited Date: 2004-05-28 Deposition Author(s): Inoue, M. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Saito, K. , Yokoyama, S.