Solution structure of the cs domain of human kiaa1068 protein
PDB DOI: 10.2210/pdb1wgv/pdb
Classification: Structural genomics, unknown function Organism(s): Homo Sapiens
Deposited: 2004-05-28 Deposition Author(s): Hayashi, F. , Inoue, M. , Kigawa, T. , Koshiba, S. , Li, H. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S.
Solution structure of the cs domain of human kiaa1068 protein
Hayashi, F. , Inoue, M. , Kigawa, T. , Koshiba, S. , Li, H. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S.
Primary Citation of Related Structures: 1WGV
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| KIAA1068 protein | A | 124 | Homo Sapiens | GSSGSSGQKNPDSYNGAVRENYTWSQDYTDLEVRVPVPKHVVKGKQVSVALSSSSIRVAMLEENGERVLMEGKLTHKINTESSLWSLEPGKCVLVNLSKVGEYWWNAILEGEEPIDIDSGPSSG |
Method: SOLUTION NMR
Deposited Date: 2004-05-28 Deposition Author(s): Hayashi, F. , Inoue, M. , Kigawa, T. , Koshiba, S. , Li, H. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S.