1WGD
Solution structure of the ubl-domain of herp
PDB DOI: 10.2210/pdb1wgd/pdb
Classification: MEMBRANE PROTEIN Organism(s): Homo Sapiens
Deposited: 2004-05-28 Deposition Author(s): Inoue, M. , Kigawa, T. , Koshiba, S. , Nakanishi, T. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Solution structure of the ubl-domain of herp
Inoue, M. , Kigawa, T. , Koshiba, S. , Nakanishi, T. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S.
Primary Citation of Related Structures: 1WGD
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein | A | 93 | Homo Sapiens | GSSGSSGVTLLVKSPNQRHRDLELSGDRGWSVGHLKAHLSRVYPERPRPEDQRLIYSGKLLLDHQCLRDLLPKQEKRHVLHLVCNVKSGPSSG |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2004-05-28 Deposition Author(s): Inoue, M. , Kigawa, T. , Koshiba, S. , Nakanishi, T. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S.