Solution structure of zf-an1 domain from arabidopsis thaliana
PDB DOI: 10.2210/pdb1wg2/pdb
Classification: DNA BINDING PROTEIN Organism(s): Arabidopsis Thaliana
Deposited: 2004-05-27 Deposition Author(s): Hayashi, F. , Nagashima, T. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Suetake, T. , Yokoyama, S.
Solution structure of zf-an1 domain from arabidopsis thaliana
Hayashi, F. , Nagashima, T. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Suetake, T. , Yokoyama, S.
Primary Citation of Related Structures: 1WG2
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| zinc finger (AN1-like) family protein | A | 64 | Arabidopsis Thaliana | GSSGSSGPSRPVRPNNRCFSCNKKVGVMGFKCKCGSTFCGSHRYPEKHECSFDFKEVGSGPSSG |
Method: SOLUTION NMR
Deposited Date: 2004-05-27 Deposition Author(s): Hayashi, F. , Nagashima, T. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Suetake, T. , Yokoyama, S.