Solution structrue of the zf-an1 domain from arabidopsis thaliana at2g36320 protein
PDB DOI: 10.2210/pdb1wfh/pdb
Classification: METAL BINDING PROTEIN Organism(s): Arabidopsis Thaliana
Deposited: 2004-05-26 Deposition Author(s): Inoue, M. , Kigawa, T. , Koshiba, S. , Nemoto, N. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Tomizawa, T. , Yokoyama, S.
Method: SOLUTION NMR Resolution: N.A.
Solution structrue of the zf-an1 domain from arabidopsis thaliana at2g36320 protein
Inoue, M. , Kigawa, T. , Koshiba, S. , Nemoto, N. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Tomizawa, T. , Yokoyama, S.
Primary Citation of Related Structures: 1WFH
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
zinc finger (AN1-like) family protein | A | 64 | Arabidopsis Thaliana | GSSGSSGQPSPPQRPNRCTVCRKRVGLTGFMCRCGTTFCGSHRYPEVHGCTFDFKSAGSGPSSG |
Method: SOLUTION NMR
Deposited Date: 2004-05-26 Deposition Author(s): Inoue, M. , Kigawa, T. , Koshiba, S. , Nemoto, N. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Tomizawa, T. , Yokoyama, S.