Solution structure of ring-finger in the catalytic subunit (irx3) of cellulose synthase
PDB DOI: 10.2210/pdb1weo/pdb
Classification: DNA BINDING PROTEIN Organism(s): Arabidopsis Thaliana
Deposited: 2004-05-25 Deposition Author(s): He, F. , Inoue, M. , Kigawa, T. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Terada, T. , Yokoyama, S.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of ring-finger in the catalytic subunit (irx3) of cellulose synthase
He, F. , Inoue, M. , Kigawa, T. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Terada, T. , Yokoyama, S.
Primary Citation of Related Structures: 1WEO
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| cellulose synthase, catalytic subunit (IRX3) | A | 93 | Arabidopsis Thaliana | GSSGSSGPKPLKNLDGQFCEICGDQIGLTVEGDLFVACNECGFPACRPCYEYERREGTQNCPQCKTRYKRLRGSPRVEGDEDEEDIDSGPSSG |
Method: SOLUTION NMR
Deposited Date: 2004-05-25 Deposition Author(s): He, F. , Inoue, M. , Kigawa, T. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Terada, T. , Yokoyama, S.