1WEN
Solution structure of phd domain in ing1-like protein bac25079
PDB DOI: 10.2210/pdb1wen/pdb
Classification: DNA BINDING PROTEIN Organism(s): Mus Musculus
Deposited: 2004-05-25 Deposition Author(s): He, F. , Inoue, M. , Kigawa, T. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Terada, T. , Yokoyama, S.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Solution structure of phd domain in ing1-like protein bac25079
He, F. , Inoue, M. , Kigawa, T. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Terada, T. , Yokoyama, S.
Primary Citation of Related Structures: 1WEN
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| inhibitor of growth family, member 4; ING1-like protein | A | 71 | Mus Musculus | GSSGSSGDMPVDPNEPTYCLCHQVSYGEMIGCDNPDCSIEWFHFACVGLTTKPRGKWFCPRCSQESGPSSG |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2004-05-25 Deposition Author(s): He, F. , Inoue, M. , Kigawa, T. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Terada, T. , Yokoyama, S.