Nmr structure determination of the bacterial mercury transporter, merf, in micelles
PDB DOI: 10.2210/pdb1waz/pdb
Classification: TRANSPORT PROTEIN Organism(s): Morganella Morganii
Deposited: 2004-10-28 Deposition Author(s): Howell, S.C. , Mesleh, M.F. , Opella, S.J.
Nmr structure determination of the bacterial mercury transporter, merf, in micelles
Howell, S.C. , Mesleh, M.F. , Opella, S.J.
Primary Citation of Related Structures: 1WAZ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| MERF | A | 46 | Morganella Morganii | TPVLVILLGVVGLSALTGYLDYVLLPALAIFIGLTIYAIQRKRQAD |
Method: SOLUTION NMR
Deposited Date: 2004-10-28 Deposition Author(s): Howell, S.C. , Mesleh, M.F. , Opella, S.J.