Gene v protein (single-stranded dna binding protein)
PDB DOI: 10.2210/pdb1vqb/pdb
Classification: DNA BINDING PROTEIN Organism(s): Enterobacteria Phage F1
Deposited: 1996-08-14 Deposition Author(s): Bellamy, H. , Gray, C.W. , Guan, Y. , Konings, R.N.H. , Leschnitzer, D.H. , Skinner, M.M. , Sweet, R.M. , Terwilliger, T.C. , Wang, A.H.-J. , Zhang, H.
Gene v protein (single-stranded dna binding protein)
Bellamy, H. , Gray, C.W. , Guan, Y. , Konings, R.N.H. , Leschnitzer, D.H. , Skinner, M.M. , Sweet, R.M. , Terwilliger, T.C. , Wang, A.H.-J. , Zhang, H.
Primary Citation of Related Structures: 1VQB
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| GENE V PROTEIN | A | 87 | Enterobacteria Phage F1 | MIKVEIKPSQAQFTTRSGVSRQGKPYSLNEQLCYVDLGNEYPVLVKITLDEGQPAYAPGLYTVHLSSFKVGQFGSLMIDRLRLVPAK |
Method: X-RAY DIFFRACTION
Deposited Date: 1996-08-14 Deposition Author(s): Bellamy, H. , Gray, C.W. , Guan, Y. , Konings, R.N.H. , Leschnitzer, D.H. , Skinner, M.M. , Sweet, R.M. , Terwilliger, T.C. , Wang, A.H.-J. , Zhang, H.