Vnd/nk-2 protein (homeodomain), nmr
PDB DOI: 10.2210/pdb1vnd/pdb
Classification: DNA BINDING PROTEIN Organism(s): Drosophila Melanogaster
Deposited: 1996-05-22 Deposition Author(s): Ferretti, J.A. , Gruschus, J.M. , Nirenberg, M. , Tsao, D.H.H. , Wang, L.-H.
Vnd/nk-2 protein (homeodomain), nmr
Ferretti, J.A. , Gruschus, J.M. , Nirenberg, M. , Tsao, D.H.H. , Wang, L.-H.
Primary Citation of Related Structures: 1VND
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| VND/NK-2 PROTEIN | A | 77 | Drosophila Melanogaster | ASDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHP |
Method: SOLUTION NMR
Deposited Date: 1996-05-22 Deposition Author(s): Ferretti, J.A. , Gruschus, J.M. , Nirenberg, M. , Tsao, D.H.H. , Wang, L.-H.