Nmr study of vigilin, repeat 6, minimized average structure
PDB DOI: 10.2210/pdb1vih/pdb
Classification: RIBONUCLEOPROTEIN Organism(s): Homo Sapiens
Deposited: 1995-11-29 Deposition Author(s): Gibson, T.J. , Joseph, C. , Morelli, M.A.C. , Musco, G. , Nilges, M. , Pastore, A. , Stier, G.
Method: SOLUTION NMR Resolution: N.A.
Nmr study of vigilin, repeat 6, minimized average structure
Gibson, T.J. , Joseph, C. , Morelli, M.A.C. , Musco, G. , Nilges, M. , Pastore, A. , Stier, G.
Primary Citation of Related Structures: 1VIH
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| VIGILIN | A | 71 | Homo Sapiens | INRMDYVEINIDHKFHRHLIGKSGANINRIKDQYKVSVRIPPDSEKSNLIRIEGDPQGVQQAKRELLELAS |
Method: SOLUTION NMR
Deposited Date: 1995-11-29 Deposition Author(s): Gibson, T.J. , Joseph, C. , Morelli, M.A.C. , Musco, G. , Nilges, M. , Pastore, A. , Stier, G.