Solution structure of vhr1, the first cyclotide from root tissue
PDB DOI: 10.2210/pdb1vb8/pdb
Classification: PLANT PROTEIN Organism(s): Viola Hederacea
Deposited: 2004-02-25 Deposition Author(s): Craik, D.J. , Trabi, M.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of vhr1, the first cyclotide from root tissue
Primary Citation of Related Structures: 1VB8
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Viola hederacea root peptide 1 | A | 30 | Viola Hederacea | CAESCVWIPCTVTALLGCSCSNKVCYNGIP |
Method: SOLUTION NMR
Deposited Date: 2004-02-25 Deposition Author(s): Craik, D.J. , Trabi, M.