1VA2
Solution structure of transcription factor sp1 dna binding domain (zinc finger 2)
PDB DOI: 10.2210/pdb1va2/pdb
Classification: TRANSCRIPTION Organism(s): Homo Sapiens
Deposited: 2004-02-07 Deposition Author(s): Kobayashi, Y. , Ohkubo, T. , Oka, S. , Shiraishi, Y. , Sugiura, Y. , Yoshida, T.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Solution structure of transcription factor sp1 dna binding domain (zinc finger 2)
Kobayashi, Y. , Ohkubo, T. , Oka, S. , Shiraishi, Y. , Sugiura, Y. , Yoshida, T.
Primary Citation of Related Structures: 1VA2
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Transcription factor Sp1 | A | 31 | Homo Sapiens | RPFMCTWSYCGKRFTRSDELQRHKRTHTGEK |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2004-02-07 Deposition Author(s): Kobayashi, Y. , Ohkubo, T. , Oka, S. , Shiraishi, Y. , Sugiura, Y. , Yoshida, T.