Solution structure of human p53 binding domain of pias-1
PDB DOI: 10.2210/pdb1v66/pdb
Classification: LIGASE Organism(s): Salmonella Enterica
Deposited: 2003-11-27 Deposition Author(s): Hara, F. , Hatanaka, H. , Okubo, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shimotakahara, S. , Shindo, H. , Suzuki, S. , Tanaka, H. , Tsuchida, Y. , Yasuda, H. , Yokoyama, S.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of human p53 binding domain of pias-1
Hara, F. , Hatanaka, H. , Okubo, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shimotakahara, S. , Shindo, H. , Suzuki, S. , Tanaka, H. , Tsuchida, Y. , Yasuda, H. , Yokoyama, S.
Primary Citation of Related Structures: 1V66
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Protein inhibitor of activated STAT protein 1 | A | 65 | Salmonella Enterica | MADSAELKQMVMSLRVSELQVLLGYAGRNKHGRKHELLTKALHLLKAGCSPAVQMKIKELYRRRF |
Method: SOLUTION NMR
Deposited Date: 2003-11-27 Deposition Author(s): Hara, F. , Hatanaka, H. , Okubo, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shimotakahara, S. , Shindo, H. , Suzuki, S. , Tanaka, H. , Tsuchida, Y. , Yasuda, H. , Yokoyama, S.