Solution structure of the kruppel-associated box (krab) domain
PDB DOI: 10.2210/pdb1v65/pdb
Classification: GENE REGULATION Organism(s): Mus Musculus
Deposited: 2003-11-27 Deposition Author(s): Inoue, M. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Saito, K. , Yokoyama, S.
Solution structure of the kruppel-associated box (krab) domain
Inoue, M. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Saito, K. , Yokoyama, S.
Primary Citation of Related Structures: 1V65
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| RIKEN cDNA 2610044O15 | A | 64 | Mus Musculus | GSSGSSGVTYDDVHMNFTEEEWDLLDSSQKRLYEEVMLETYQNLTDIGYNWQDHHIEESGPSSG |
Method: SOLUTION NMR
Deposited Date: 2003-11-27 Deposition Author(s): Inoue, M. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Saito, K. , Yokoyama, S.