Solution structure of the herg k+ channel s5-p extracellular linker
PDB DOI: 10.2210/pdb1ujl/pdb
Classification: MEMBRANE PROTEIN Organism(s): N.A.
Deposited: 2003-08-05 Deposition Author(s): Alewood, P.F. , Bansal, P.S. , Bauskin, A. , Breit, S.N. , Bursill, J.A. , Campbell, T.J. , Clarke, C.E. , Kuchel, P.W. , Smith, D.J. , Sunde, M. , Torres, A.M. , Vandenberg, J.I.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of the herg k+ channel s5-p extracellular linker
Alewood, P.F. , Bansal, P.S. , Bauskin, A. , Breit, S.N. , Bursill, J.A. , Campbell, T.J. , Clarke, C.E. , Kuchel, P.W. , Smith, D.J. , Sunde, M. , Torres, A.M. , Vandenberg, J.I.
Primary Citation of Related Structures: 1UJL
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Potassium voltage-gated channel subfamily H member 2 | A | 42 | N.A. | AIGNMEQPHMDSRIGWLHNLGDQIGKPYNSSGLGGPSIKDKY |
Method: SOLUTION NMR
Deposited Date: 2003-08-05 Deposition Author(s): Alewood, P.F. , Bansal, P.S. , Bauskin, A. , Breit, S.N. , Bursill, J.A. , Campbell, T.J. , Clarke, C.E. , Kuchel, P.W. , Smith, D.J. , Sunde, M. , Torres, A.M. , Vandenberg, J.I.