Solution structure of hbs1-like domain in hypothetical protein bab28515
PDB DOI: 10.2210/pdb1ufz/pdb
Classification: TRANSLATION Organism(s): Mus Musculus
Deposited: 2003-06-11 Deposition Author(s): Aoki, M. , Hayami, N. , Hayashizaki, Y. , He, F. , Hirota, H. , Inoue, M. , Kigawa, T. , Kobayashi, N. , Matsuda, T. , Matsuo, Y. , Muto, Y. , Osanai, T. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Seki, E. , Shirouzu, M. , Tanaka, A. , Terada, T. , Yabuki, T. , Yokoyama, S. , Yoshida, M.
Solution structure of hbs1-like domain in hypothetical protein bab28515
Aoki, M. , Hayami, N. , Hayashizaki, Y. , He, F. , Hirota, H. , Inoue, M. , Kigawa, T. , Kobayashi, N. , Matsuda, T. , Matsuo, Y. , Muto, Y. , Osanai, T. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Seki, E. , Shirouzu, M. , Tanaka, A. , Terada, T. , Yabuki, T. , Yokoyama, S. , Yoshida, M.
Primary Citation of Related Structures: 1UFZ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence | 
| Hypothetical protein BAB28515 | A | 83 | Mus Musculus | GSSGSSGEYGYEDLRESSNSLLNHQLSEIDQARLYSCLDHMREVLGDAVPDDILTEAILKHKFDVQKALSVVLEQDGSGPSSG | 
Method: SOLUTION NMR
Deposited Date: 2003-06-11 Deposition Author(s): Aoki, M. , Hayami, N. , Hayashizaki, Y. , He, F. , Hirota, H. , Inoue, M. , Kigawa, T. , Kobayashi, N. , Matsuda, T. , Matsuo, Y. , Muto, Y. , Osanai, T. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Seki, E. , Shirouzu, M. , Tanaka, A. , Terada, T. , Yabuki, T. , Yokoyama, S. , Yoshida, M.
 
                  