Crystal structure of chey d13k y106w alone and in complex with a flim peptide
PDB DOI: 10.2210/pdb1u8t/pdb
Classification: SIGNALING PROTEIN Organism(s): Adineta Vaga , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2004-08-06 Deposition Author(s): Campos, A. , Dahlquist, F.W. , Dyer, C.M. , Hausrath, A.C. , Lu, J. , Matsumura, P. , Matthews, B.W. , Mcevoy, M.M. , Quillin, M.L. , Westbrook, E.M.
Crystal structure of chey d13k y106w alone and in complex with a flim peptide
Campos, A. , Dahlquist, F.W. , Dyer, C.M. , Hausrath, A.C. , Lu, J. , Matsumura, P. , Matthews, B.W. , Mcevoy, M.M. , Quillin, M.L. , Westbrook, E.M.
Primary Citation of Related Structures: 1U8T
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Chemotaxis protein cheY | A | 128 | Adineta Vaga , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | ADKELKFLVVDKFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRADGAMSALPVLMVTAEAKKENIIAAAQAGASGWVVKPFTAATLEEKLNKIFEKLGM |
Chemotaxis protein cheY | B | 128 | Adineta Vaga , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | ADKELKFLVVDKFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRADGAMSALPVLMVTAEAKKENIIAAAQAGASGWVVKPFTAATLEEKLNKIFEKLGM |
Chemotaxis protein cheY | C | 128 | Adineta Vaga , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | ADKELKFLVVDKFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRADGAMSALPVLMVTAEAKKENIIAAAQAGASGWVVKPFTAATLEEKLNKIFEKLGM |
Chemotaxis protein cheY | D | 128 | Adineta Vaga , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | ADKELKFLVVDKFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRADGAMSALPVLMVTAEAKKENIIAAAQAGASGWVVKPFTAATLEEKLNKIFEKLGM |
Flagellar motor switch protein fliM | E | 16 | Adineta Vaga , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MGDSILSQAEIDALLN |
Flagellar motor switch protein fliM | F | 16 | Adineta Vaga , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MGDSILSQAEIDALLN |
Method: X-RAY DIFFRACTION
Deposited Date: 2004-08-06 Deposition Author(s): Campos, A. , Dahlquist, F.W. , Dyer, C.M. , Hausrath, A.C. , Lu, J. , Matsumura, P. , Matthews, B.W. , Mcevoy, M.M. , Quillin, M.L. , Westbrook, E.M.