Solution structure of a diiron protein model
PDB DOI: 10.2210/pdb1u7j/pdb
Classification: DE NOVO PROTEIN Organism(s): Escherichia Coli
Deposited: 2004-08-04 Deposition Author(s): Calhoun, J.R. , Degrado, W.F. , Lahr, S. , Lombardi, A. , Maglio, O. , Nastri, F. , Pavone, V.
Solution structure of a diiron protein model
Calhoun, J.R. , Degrado, W.F. , Lahr, S. , Lombardi, A. , Maglio, O. , Nastri, F. , Pavone, V.
Primary Citation of Related Structures: 1U7J
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Four-helix bundle model | A | 49 | Escherichia Coli | MDYLRELYKLEQQAMKLYREASERVGDPVLAKILEDEEKHIEWLETING |
| Four-helix bundle model | B | 49 | Escherichia Coli | MDYLRELYKLEQQAMKLYREASERVGDPVLAKILEDEEKHIEWLETING |
Method: SOLUTION NMR
Deposited Date: 2004-08-04 Deposition Author(s): Calhoun, J.R. , Degrado, W.F. , Lahr, S. , Lombardi, A. , Maglio, O. , Nastri, F. , Pavone, V.