1U57
Nmr structure of the (345-392)gag sequence from hiv-1
PDB DOI: 10.2210/pdb1u57/pdb
Classification: VIRAL PROTEIN Organism(s): Human Immunodeficiency Virus 1
Deposited: 2004-07-27 Deposition Author(s): Bouaziz, S. , Druillennec, S. , Lenoir, C. , Morellet, N. , Roques, B.P.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Nmr structure of the (345-392)gag sequence from hiv-1
Bouaziz, S. , Druillennec, S. , Lenoir, C. , Morellet, N. , Roques, B.P.
Primary Citation of Related Structures: 1U57
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Gag polyprotein | A | 48 | Human Immunodeficiency Virus 1 | LEEMMTACQGVGGPGHKARVLAEAMSQVTNSATIMMQRGNFRNQRKIV |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2004-07-27 Deposition Author(s): Bouaziz, S. , Druillennec, S. , Lenoir, C. , Morellet, N. , Roques, B.P.