1U38
Auto-inhibition mechanism of x11s/mints family scaffold proteins revealed by the closed conformation of the tandem pdz domains
PDB DOI: 10.2210/pdb1u38/pdb
Classification: PROTEIN TRANSPORT Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2004-07-21 Deposition Author(s): Chan, L.-N. , Feng, W. , Fu, A. , He, C. , Ip, N.Y. , Long, J.-F. , Xia, J. , Zhang, M.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Auto-inhibition mechanism of x11s/mints family scaffold proteins revealed by the closed conformation of the tandem pdz domains
Chan, L.-N. , Feng, W. , Fu, A. , He, C. , Ip, N.Y. , Long, J.-F. , Xia, J. , Zhang, M.
Primary Citation of Related Structures: 1U38
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| amyloid beta A4 precursor protein-binding, family A, member 1 | A | 89 | Homo Sapiens , Synthetic Construct | EFKDVFIEKQKGEILGVVIVESGWGSILPTVIIANMMHGGPAEKSGKLNIGDQIMSINGTSLVGLPLSTCQSIIKGLKNQSRVKLNIVR |
| PVYI | B | 4 | Homo Sapiens , Synthetic Construct | PVYI |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2004-07-21 Deposition Author(s): Chan, L.-N. , Feng, W. , Fu, A. , He, C. , Ip, N.Y. , Long, J.-F. , Xia, J. , Zhang, M.