Crystal structure of chicken alpha-spectrin sh3 domain
PDB DOI: 10.2210/pdb1u06/pdb
Classification: STRUCTURAL PROTEIN Organism(s): Gallus Gallus
Deposited: 2004-07-13 Deposition Author(s): Chevelkov, V. , Diehl, A. , Faelber, K. , Heinemann, U. , Oschkinat, H. , Reif, B.
Crystal structure of chicken alpha-spectrin sh3 domain
Chevelkov, V. , Diehl, A. , Faelber, K. , Heinemann, U. , Oschkinat, H. , Reif, B.
Primary Citation of Related Structures: 1U06
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Spectrin alpha chain, brain | A | 62 | Gallus Gallus | MDETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLD |
Method: X-RAY DIFFRACTION
Deposited Date: 2004-07-13 Deposition Author(s): Chevelkov, V. , Diehl, A. , Faelber, K. , Heinemann, U. , Oschkinat, H. , Reif, B.