[pnpy19-23]-hpp bound to dpc micelles
PDB DOI: 10.2210/pdb1tz5/pdb
Classification: HORMONE/GROWTH FACTOR Organism(s): Homo Sapiens , Sus Scrofa
Deposited: 2004-07-09 Deposition Author(s): Aguilar, M.I. , Beck-Sickinger, A.G. , Folkers, G. , Kamimori, H. , Lerch, M. , Zerbe, O.
[pnpy19-23]-hpp bound to dpc micelles
Aguilar, M.I. , Beck-Sickinger, A.G. , Folkers, G. , Kamimori, H. , Lerch, M. , Zerbe, O.
Primary Citation of Related Structures: 1TZ5
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Pancreatic prohormone,neuropeptide Y,Pancreatic prohormone | A | 37 | Homo Sapiens , Sus Scrofa | APLEPVYPGDNATPEQMARYYSALRRYINMLTRPRYX |
Method: SOLUTION NMR
Deposited Date: 2004-07-09 Deposition Author(s): Aguilar, M.I. , Beck-Sickinger, A.G. , Folkers, G. , Kamimori, H. , Lerch, M. , Zerbe, O.