Solution structure of tm1509 from thermotoga maritima: vt1, a nesgc target protein
PDB DOI: 10.2210/pdb1tvi/pdb
Classification: STRUCTURAL GENOMICS, UNKNOWN FUNCTION Organism(s): Thermotoga Maritima
Deposited: 2004-06-29 Deposition Author(s): Arrowsmith, C.H. , Atreya, H.S. , Kim, S. , Li, Z. , Murray, D. , Northeast Structural Genomics Consortium (Nesg) , Penhoat, C.H. , Szyperski, T. , Xiao, R. , Yee, A.
Solution structure of tm1509 from thermotoga maritima: vt1, a nesgc target protein
Arrowsmith, C.H. , Atreya, H.S. , Kim, S. , Li, Z. , Murray, D. , Northeast Structural Genomics Consortium (Nesg) , Penhoat, C.H. , Szyperski, T. , Xiao, R. , Yee, A.
Primary Citation of Related Structures: 1TVI
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Hypothetical UPF0054 protein TM1509 | A | 172 | Thermotoga Maritima | MGTSHHHHHHSSGRENLYFQGHMIRILGEGKGSKLLENLKEKLEEIVKKEIGDVHVNVILVSEDEIKELNQQFRGQDRPTDVLTFPLMEEDVYGEIYVCPLIVEENAREFNNTFEKELLEVVIHGILHLAGYDHEFEDKNSKEMFEKQKKYVEEVWGEWRSNPSEDSDPGKR |
Method: SOLUTION NMR
Deposited Date: 2004-06-29 Deposition Author(s): Arrowsmith, C.H. , Atreya, H.S. , Kim, S. , Li, Z. , Murray, D. , Northeast Structural Genomics Consortium (Nesg) , Penhoat, C.H. , Szyperski, T. , Xiao, R. , Yee, A.