Solution structure of cryptdin-4, the most potent alpha-defensin from mouse paneth cells
PDB DOI: 10.2210/pdb1tv0/pdb
Classification: ANTIMICROBIAL PROTEIN Organism(s): Enterobacter Aerogenes
Deposited: 2004-06-25 Deposition Author(s): Hunter, H.N. , Jing, W. , Ouellette, A.J. , Tanabe, H. , Vogel, H.J.
Solution structure of cryptdin-4, the most potent alpha-defensin from mouse paneth cells
Hunter, H.N. , Jing, W. , Ouellette, A.J. , Tanabe, H. , Vogel, H.J.
Primary Citation of Related Structures: 1TV0
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Cryptdin-4 | A | 32 | Enterobacter Aerogenes | GLLCYCRKGHCKRGERVRGTCGIRFLYCCPRR |
Method: SOLUTION NMR
Deposited Date: 2004-06-25 Deposition Author(s): Hunter, H.N. , Jing, W. , Ouellette, A.J. , Tanabe, H. , Vogel, H.J.