Structure of the pr cis planar intermediate from time-resolved laue crystallography
PDB DOI: 10.2210/pdb1ts8/pdb
Classification: photoreceptor Organism(s): Halorhodospira Halophila
Deposited: 2004-06-21 Deposition Author(s): Anderson, S. , Anfinrud, P.A. , Ihee, H. , Moffat, K. , Pahl, R. , Rajagopal, S. , Schmidt, M. , Schotte, F. , Srajer, V. , Wulff, M.
Structure of the pr cis planar intermediate from time-resolved laue crystallography
Anderson, S. , Anfinrud, P.A. , Ihee, H. , Moffat, K. , Pahl, R. , Rajagopal, S. , Schmidt, M. , Schotte, F. , Srajer, V. , Wulff, M.
Primary Citation of Related Structures: 1TS8
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Photoactive yellow protein | A | 125 | Halorhodospira Halophila | MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV |
Method: X-RAY DIFFRACTION
Deposited Date: 2004-06-21 Deposition Author(s): Anderson, S. , Anfinrud, P.A. , Ihee, H. , Moffat, K. , Pahl, R. , Rajagopal, S. , Schmidt, M. , Schotte, F. , Srajer, V. , Wulff, M.