Covalent reaction intermediate revealed in crystal structure of the geobacillus stearothermophilus carboxylesterase est30
PDB DOI: 10.2210/pdb1tqh/pdb
Classification: HYDROLASE Organism(s): Geobacillus Stearothermophilus
Deposited: 2004-06-17 Deposition Author(s): Abdelal, A.T. , Ewis, H.E. , Harrison, R.W. , Liu, P. , Lu, C.D. , Wang, Y.F. , Weber, I.T.
Covalent reaction intermediate revealed in crystal structure of the geobacillus stearothermophilus carboxylesterase est30
Abdelal, A.T. , Ewis, H.E. , Harrison, R.W. , Liu, P. , Lu, C.D. , Wang, Y.F. , Weber, I.T.
Primary Citation of Related Structures: 1TQH
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Carboxylesterase precursor | A | 247 | Geobacillus Stearothermophilus | MMKIVPPKPFFFEAGERAVLLLHGFTGNSADVRMLGRFLESKGYTCHAPIYKGHGVPPEELVHTGPDDWWQDVMNGYEFLKNKGYEKIAVAGLSLGGVFSLKLGYTVPIEGIVTMCAPMYIKSEETMYEGVLEYAREYKKREGKSEEQIEQEMEKFKQTPMKTLKALQELIADVRDHLDLIYAPTFVVQARHDEMINPDSANIIYNEIESPVKQIKWYEQSGHVITLDQEKDQLHEDIYAFLESLDW |
Method: X-RAY DIFFRACTION
Deposited Date: 2004-06-17 Deposition Author(s): Abdelal, A.T. , Ewis, H.E. , Harrison, R.W. , Liu, P. , Lu, C.D. , Wang, Y.F. , Weber, I.T.