PDBi (Protein Data Bank in India)

All in One Protein Databank
Home About Help Resources External Links Contact Us
Advanced Search
FASTA Sequence PDB Format mmCIF Format
FASTA Sequence PDB Format PDB Format(gz) PDBx/mmCIF Format PDBx/mmCIF Format(gz) PDBML/XML Format Validation Full PDF Validation CIF

1TP3

Pdz3 domain of psd-95 protein complexed with kketpv peptide ligand

PDB DOI: 10.2210/pdb1tp3/pdb

Classification: PROTEIN BINDING
Organism(s): Pandinus Imperator , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)

Deposited: 2004-06-15
Deposition Author(s): Griffin, A. , Kovari, L.C. , Martin, P. , Saro, D. , Spaller, M.R. , Vickrey, J.F.

Experimental Data Snapshot

Method: X-RAY DIFFRACTION
Resolution: 1.99 Å

Literature

Pdz3 domain of psd-95 protein complexed with kketpv peptide ligand

Griffin, A. , Kovari, L.C. , Martin, P. , Saro, D. , Spaller, M.R. , Vickrey, J.F.

Primary Citation of Related Structures: 1TP3


Proteins
Molecule Chains Sequence Length Organism Sequence
Presynaptic density protein 95 A 119 Pandinus Imperator , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) GSPEFLGEEDIPREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYKPEEYSRFEANSRVDSSGRIVTD
KKETPV peptide ligand B 6 Pandinus Imperator , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) KKETPV
Experimental Data

Method: X-RAY DIFFRACTION

Deposited Date: 2004-06-15
Deposition Author(s): Griffin, A. , Kovari, L.C. , Martin, P. , Saro, D. , Spaller, M.R. , Vickrey, J.F.