Solution structure of a calmodulin-like calcium-binding domain from arabidopsis thaliana
PDB DOI: 10.2210/pdb1tiz/pdb
Classification: Calcium-Binding Protein Organism(s): Arabidopsis Thaliana
Deposited: 2004-06-02 Deposition Author(s): Center For Eukaryotic Structural Genomics (Cesg) , Frederick, R.O. , Markley, J.L. , Song, J. , Thao, S. , Zhao, Q.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of a calmodulin-like calcium-binding domain from arabidopsis thaliana
Center For Eukaryotic Structural Genomics (Cesg) , Frederick, R.O. , Markley, J.L. , Song, J. , Thao, S. , Zhao, Q.
Primary Citation of Related Structures: 1TIZ
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
calmodulin-related protein, putative | A | 67 | Arabidopsis Thaliana | SSAKRVFEKFDKNKDGKLSLDEFREVALAFSPYFTQEDIVKFFEEIDVDGNGELNADEFTSCIEKML |
Method: SOLUTION NMR
Deposited Date: 2004-06-02 Deposition Author(s): Center For Eukaryotic Structural Genomics (Cesg) , Frederick, R.O. , Markley, J.L. , Song, J. , Thao, S. , Zhao, Q.