The structures of three crystal forms of the sweet protein thaumatin
PDB DOI: 10.2210/pdb1thv/pdb
Classification: SWEET TASTING PROTEIN Organism(s): Thaumatococcus Daniellii
Deposited: 1994-06-10 Deposition Author(s): Day, J. , Greenwood, A. , Ko, T.-P. , Mcpherson, A.
The structures of three crystal forms of the sweet protein thaumatin
Day, J. , Greenwood, A. , Ko, T.-P. , Mcpherson, A.
Primary Citation of Related Structures: 1THV
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| THAUMATIN ISOFORM A | A | 207 | Thaumatococcus Daniellii | ATFEIVNRCSYTVWAAASKGDAALDAGGRQLNSGESWTINVEPGTNGGKIWARTDCYFDDSGSGICKTGDCGGLLRCKRFGRPPTTLAEFSLNQYGKDYIDISNIKGFNVPMDFSPTTRGCRGVRCAADIVGQCPAKLKAPGGGCNDACTVFQTSEYCCTTGKCGPTEYSRFFKRLCPDAFSYVLDKPTTVTCPGSSNYRVTFCPTA |
Method: X-RAY DIFFRACTION
Deposited Date: 1994-06-10 Deposition Author(s): Day, J. , Greenwood, A. , Ko, T.-P. , Mcpherson, A.