1.8 a crystal structure of an uncharacterized b. stearothermophilus protein
PDB DOI: 10.2210/pdb1t8h/pdb
Classification: Structural Genomics, Unknown Function Organism(s): Geobacillus Stearothermophilus
Deposited: 2004-05-12 Deposition Author(s): Anderson, W.F. , Collart, F.R. , Midwest Center For Structural Genomics (Mcsg) , Minasov, G. , Mondragon, A. , Moy, S.F. , Shuvalova, L. , Taneja, B.
1.8 a crystal structure of an uncharacterized b. stearothermophilus protein
Anderson, W.F. , Collart, F.R. , Midwest Center For Structural Genomics (Mcsg) , Minasov, G. , Mondragon, A. , Moy, S.F. , Shuvalova, L. , Taneja, B.
Primary Citation of Related Structures: 1T8H
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| YlmD protein sequence homologue | A | 277 | Geobacillus Stearothermophilus | SNAMPDIFQQEARGWLRCGAPPFAGAVAGLTTKHGGESKGPFASLNMGLHVGDDRTDVVNNRRRLAEWLAFPLERWVCCEQVHGADIQKVTKSDRGNGAQDFATAVPGVDGLYTDEAGVLLALCFADCVPIYFVAPSAGLVGLAHAGWRGTAGGIAGHMVWLWQTREHIAPSDIYVAIGPAIGPCCYTVDDRVVDSLRPTLPPESPLPWRETSPGQYALDLKEANRLQLLAAGVPNSHIYVSERCTSCEEALFFSHRRDRGTTGRMLAFIGRREEWT |
Method: X-RAY DIFFRACTION
Deposited Date: 2004-05-12 Deposition Author(s): Anderson, W.F. , Collart, F.R. , Midwest Center For Structural Genomics (Mcsg) , Minasov, G. , Mondragon, A. , Moy, S.F. , Shuvalova, L. , Taneja, B.