Nucleocapsid-binding domain of the measles virus p protein (amino acids 457-507) in complex with amino acids 486-505 of the measles virus n protein
PDB DOI: 10.2210/pdb1t6o/pdb
Classification: VIRAL PROTEIN Organism(s): Measles Virus , Synthetic Construct
Deposited: 2004-05-06 Deposition Author(s): Dahlquist, F.W. , Gay, L.S. , Hamel, D.J. , Kingston, R.L. , Matthews, B.W.
Method: X-RAY DIFFRACTION Resolution: 2 Å
Nucleocapsid-binding domain of the measles virus p protein (amino acids 457-507) in complex with amino acids 486-505 of the measles virus n protein
Dahlquist, F.W. , Gay, L.S. , Hamel, D.J. , Kingston, R.L. , Matthews, B.W.
Primary Citation of Related Structures: 1T6O
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| phosphoprotein | A | 51 | Measles Virus , Synthetic Construct | GGASRSVIRSIIKSSRLEEDRKRYLMTLLDDIKGANDLAKFHQMLMKIIMK |
| linker | L | 8 | Measles Virus , Synthetic Construct | GSGSGSGS |
| phosphoprotein | B | 20 | Measles Virus , Synthetic Construct | QDSRRSADALLRLQAMAGIS |
Method: X-RAY DIFFRACTION
Deposited Date: 2004-05-06 Deposition Author(s): Dahlquist, F.W. , Gay, L.S. , Hamel, D.J. , Kingston, R.L. , Matthews, B.W.