Solution structure of double-stranded rna binding domain of s. cerevisiae rnase iii (rnt1p) in complex with the 5' terminal rna hairpin of snr47 precursor
PDB DOI: 10.2210/pdb1t4l/pdb
Classification: RNA BINDING PROTEIN/RNA Organism(s): Grouper Iridovirus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2004-04-29 Deposition Author(s): Chanfreau, G. , Feigon, J. , Henras, A. , Wu, H.
Solution structure of double-stranded rna binding domain of s. cerevisiae rnase iii (rnt1p) in complex with the 5' terminal rna hairpin of snr47 precursor
Chanfreau, G. , Feigon, J. , Henras, A. , Wu, H.
Primary Citation of Related Structures: 1T4L
Nucleic Acids / Hybrid | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
5' terminal hairpin of snR47 precursor | a | 32 | NA | GGGAUACCAUGUUCAGAAGAACGUGGUAUCUC |
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Ribonuclease III | B | 90 | Grouper Iridovirus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSLDMNAKRQLYSLIGYASLRLHYVTVKKPTAVDPNSIVECRVGDGTVLGTGVGRNIKIAGIRAAENALRDKKMLDFYAKQRAAIPRSES |
Method: SOLUTION NMR
Deposited Date: 2004-04-29 Deposition Author(s): Chanfreau, G. , Feigon, J. , Henras, A. , Wu, H.