1T31
A dual inhibitor of the leukocyte proteases cathepsin g and chymase with therapeutic efficacy in animals models of inflammation
PDB DOI: 10.2210/pdb1t31/pdb
Classification: HYDROLASE Organism(s): Homo Sapiens
Deposited: 2004-04-23 Deposition Author(s): Abraham, W.M. , Andrade-Gordon, P. , Bode, W. , Chen, Z. , Corcoran, T.W. , Damiano, B.P. , De Garavilla, L. , Derian, C.K. , Di Cera, E. , Eckardt, A.J. , Giardino, E.C. , Greco, M.N. , Haertlein, B.J. , Huber, R. , Kauffman, J.A. , Maryanoff, B.E. , Mathews, F.S. , Pereira, P.J.B. , Pineda, A.O. , Rubin, H. , Schechter, N.M. , Strobl, S. , Sukumar, N. , Wang, Z.M. , Wells, G.I.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.9 Å
A dual inhibitor of the leukocyte proteases cathepsin g and chymase with therapeutic efficacy in animals models of inflammation
Abraham, W.M. , Andrade-Gordon, P. , Bode, W. , Chen, Z. , Corcoran, T.W. , Damiano, B.P. , De Garavilla, L. , Derian, C.K. , Di Cera, E. , Eckardt, A.J. , Giardino, E.C. , Greco, M.N. , Haertlein, B.J. , Huber, R. , Kauffman, J.A. , Maryanoff, B.E. , Mathews, F.S. , Pereira, P.J.B. , Pineda, A.O. , Rubin, H. , Schechter, N.M. , Strobl, S. , Sukumar, N. , Wang, Z.M. , Wells, G.I.
Primary Citation of Related Structures: 1T31
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Chymase | A | 226 | Homo Sapiens | IIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQKNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGAAQGIVSYGRSDAKPPAVFTRISHYQPWINQILQAN |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2004-04-23 Deposition Author(s): Abraham, W.M. , Andrade-Gordon, P. , Bode, W. , Chen, Z. , Corcoran, T.W. , Damiano, B.P. , De Garavilla, L. , Derian, C.K. , Di Cera, E. , Eckardt, A.J. , Giardino, E.C. , Greco, M.N. , Haertlein, B.J. , Huber, R. , Kauffman, J.A. , Maryanoff, B.E. , Mathews, F.S. , Pereira, P.J.B. , Pineda, A.O. , Rubin, H. , Schechter, N.M. , Strobl, S. , Sukumar, N. , Wang, Z.M. , Wells, G.I.