Structural basis for 3' end recognition of nucleic acids by the drosophila argonaute 2 paz domain
PDB DOI: 10.2210/pdb1t2r/pdb
Classification: NUCLEIC ACID BINDING PROTEIN/RNA Organism(s): Murine Hepatitis Virus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2004-04-22 Deposition Author(s): Izaurralde, E. , Lingel, A. , Sattler, M. , Simon, B.
Method: SOLUTION NMR Resolution: N.A.
Structural basis for 3' end recognition of nucleic acids by the drosophila argonaute 2 paz domain
Izaurralde, E. , Lingel, A. , Sattler, M. , Simon, B.
Primary Citation of Related Structures: 1T2R
Nucleic Acids / Hybrid | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
5'-R(*CP*UP*CP*AP*C)-3' | b | 5 | NA | CUCAC |
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Argonaute 2 | A | 123 | Murine Hepatitis Virus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GAMAMPMIEYLERFSLKAKINNTTNLDYSRRFLEPFLRGINVVYTPPQSFQSAPRVYRVNGLSRAPASSETFEHDGKKVTIASYFHSRNYPLKFPQLHCLNVGSSIKSILLPIELCSIEEGQA |
Method: SOLUTION NMR
Deposited Date: 2004-04-22 Deposition Author(s): Izaurralde, E. , Lingel, A. , Sattler, M. , Simon, B.