1SSZ
Conformational mapping of mini-b: an n-terminal/c-terminal construct of surfactant protein b using 13c-enhanced fourier transform infrared (ftir) spectroscopy
PDB DOI: 10.2210/pdb1ssz/pdb
Classification: SURFACE ACTIVE PROTEIN Organism(s): N.A.
Deposited: 2004-03-24 Deposition Author(s): Alig, T. , Alonso, C. , Bacon, D. , Braun, A. , Gordon, L.M. , Hernandez-Juviel, J.M. , Hong, T. , Sherman, M.A. , Walther, F.J. , Waring, A.J. , Zasadzinski, J.A.
Experimental Data Snapshot
Method: INFRARED SPECTROSCOPY
Conformational mapping of mini-b: an n-terminal/c-terminal construct of surfactant protein b using 13c-enhanced fourier transform infrared (ftir) spectroscopy
Alig, T. , Alonso, C. , Bacon, D. , Braun, A. , Gordon, L.M. , Hernandez-Juviel, J.M. , Hong, T. , Sherman, M.A. , Walther, F.J. , Waring, A.J. , Zasadzinski, J.A.
Primary Citation of Related Structures: 1SSZ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Pulmonary surfactant-associated protein B | A | 34 | N.A. | CWLCRALIKRIQAMIPKGGRMLPQLVCRLVLRCS |
Experimental Data
Method: INFRARED SPECTROSCOPY
Deposited Date: 2004-03-24 Deposition Author(s): Alig, T. , Alonso, C. , Bacon, D. , Braun, A. , Gordon, L.M. , Hernandez-Juviel, J.M. , Hong, T. , Sherman, M.A. , Walther, F.J. , Waring, A.J. , Zasadzinski, J.A.