1SSH
Crystal structure of the sh3 domain from a s. cerevisiae hypothetical 40.4 kda protein in complex with a peptide
PDB DOI: 10.2210/pdb1ssh/pdb
Classification: CONTRACTILE PROTEIN Organism(s): Grouper Iridovirus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2004-03-24 Deposition Author(s): Kursula, I. , Kursula, P. , Lehmann, F. , Song, Y.-H. , Wilmanns, M.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.4 Å
Crystal structure of the sh3 domain from a s. cerevisiae hypothetical 40.4 kda protein in complex with a peptide
Kursula, I. , Kursula, P. , Lehmann, F. , Song, Y.-H. , Wilmanns, M.
Primary Citation of Related Structures: 1SSH
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Hypothetical 40.4 kDa protein in PES4-HIS2 intergenic region | A | 60 | Grouper Iridovirus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSSPKAVALYSFAGEESGDLPFRKGDVITILKKSDSQNDWWTGRVNGREGIFPANYVELV |
| 12-mer peptide from Cytoskeleton assembly control protein SLA1 | B | 12 | Grouper Iridovirus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | EGPPPAMPARPT |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2004-03-24 Deposition Author(s): Kursula, I. , Kursula, P. , Lehmann, F. , Song, Y.-H. , Wilmanns, M.