Structure-based design of synthetic azobenzene ligands for streptavidin
PDB DOI: 10.2210/pdb1srh/pdb
Classification: BIOTIN-BINDING PROTEIN Organism(s): Streptomyces Avidinii
Deposited: 1994-02-17 Deposition Author(s): Salemme, F.R. , Weber, P.C.
Structure-based design of synthetic azobenzene ligands for streptavidin
Primary Citation of Related Structures: 1SRH
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| STREPTAVIDIN | A | 121 | Streptomyces Avidinii | AEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKV |
| STREPTAVIDIN | B | 121 | Streptomyces Avidinii | AEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKV |
Method: X-RAY DIFFRACTION
Deposited Date: 1994-02-17 Deposition Author(s): Salemme, F.R. , Weber, P.C.