1SQZ
Design of specific inhibitors of phopholipase a2: crystal structure of the complex formed between group ii phopholipase a2 and a designed peptide dehydro-ile-ala-arg-ser at 1.2a resolution
PDB DOI: 10.2210/pdb1sqz/pdb
Classification: HYDROLASE/HYDROLASE INHIBITOR Organism(s): Streptococcus Phage 73 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2004-03-22 Deposition Author(s): Bilgrami, S. , Dey, S. , Ethayathulla, A.S. , Prem Kumar, R. , Sharma, S. , Singh, N. , Singh, T.P. , Somvanshi, R.K.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.2 Å
Design of specific inhibitors of phopholipase a2: crystal structure of the complex formed between group ii phopholipase a2 and a designed peptide dehydro-ile-ala-arg-ser at 1.2a resolution
Bilgrami, S. , Dey, S. , Ethayathulla, A.S. , Prem Kumar, R. , Sharma, S. , Singh, N. , Singh, T.P. , Somvanshi, R.K.
Primary Citation of Related Structures: 1SQZ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Phospholipase A2 | A | 121 | Streptococcus Phage 73 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | SLLEFGKMILEETGKLAIPSYSSYGCYCGWGGKGTPKDATDRCCFVHDCCYGNLPDCNPKSDRYKYKRVNGAIVCEKGTSCENRICECDKAAAICFRQNLNTYSKKYMLYPDFLCKGELKC |
| synthetic peptide | B | 5 | Streptococcus Phage 73 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | XIARS |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2004-03-22 Deposition Author(s): Bilgrami, S. , Dey, S. , Ethayathulla, A.S. , Prem Kumar, R. , Sharma, S. , Singh, N. , Singh, T.P. , Somvanshi, R.K.