Solution structure of the s1 domain of rnase e from e. coli
PDB DOI: 10.2210/pdb1slj/pdb
Classification: HYDROLASE Organism(s): Escherichia Coli
Deposited: 2004-03-05 Deposition Author(s): Cook, M.A. , Edge, R.E. , Lario, P. , Mackie, G.A. , Mcintosh, L.P. , Schubert, M. , Strynadka, N.C.J.
Solution structure of the s1 domain of rnase e from e. coli
Cook, M.A. , Edge, R.E. , Lario, P. , Mackie, G.A. , Mcintosh, L.P. , Schubert, M. , Strynadka, N.C.J.
Primary Citation of Related Structures: 1SLJ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Ribonuclease E | A | 96 | Escherichia Coli | GSHMLEQKKANIYKGKITRIEPSLEAAFVDYGAERHGFLPLKEIAREYFPANYSAHGRPNIKDVLREGQEVIVQIDKEERGNKGAALTTFISLAGS |
Method: SOLUTION NMR
Deposited Date: 2004-03-05 Deposition Author(s): Cook, M.A. , Edge, R.E. , Lario, P. , Mackie, G.A. , Mcintosh, L.P. , Schubert, M. , Strynadka, N.C.J.