The binding domain of skn-1 in complex with dna: a new dna-binding motif
PDB DOI: 10.2210/pdb1skn/pdb
Classification: TRANSCRIPTION/DNA Organism(s): Human Herpesvirus 6B (Strain Hst) , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 1998-03-30 Deposition Author(s): Bowerman, B. , Daughdrill, G.W. , Matthews, B.W. , Rupert, P.B.
Method: X-RAY DIFFRACTION Resolution: 2.5 Å
The binding domain of skn-1 in complex with dna: a new dna-binding motif
Bowerman, B. , Daughdrill, G.W. , Matthews, B.W. , Rupert, P.B.
Primary Citation of Related Structures: 1SKN
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
DNA-BINDING DOMAIN OF SKN-1 | P | 92 | Human Herpesvirus 6B (Strain Hst) , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MGHHHHHHSGQRKRGRQSKDEQLASDNELPVSAFQISEMSLSELQQVLKNESLSEYQRQLIRKIRRRGKNKVAARTCRQRRTDRHDKMSHYI |
Method: X-RAY DIFFRACTION
Deposited Date: 1998-03-30 Deposition Author(s): Bowerman, B. , Daughdrill, G.W. , Matthews, B.W. , Rupert, P.B.