N-terminal (1-30) of bovine prion protein
PDB DOI: 10.2210/pdb1skh/pdb
Classification: UNKNOWN FUNCTION Organism(s): Bos Taurus
Deposited: 2004-03-05 Deposition Author(s): Andersson, A. , Biverstahl, H. , Graslund, A. , Maler, L.
Method: SOLUTION NMR Resolution: N.A.
N-terminal (1-30) of bovine prion protein
Andersson, A. , Biverstahl, H. , Graslund, A. , Maler, L.
Primary Citation of Related Structures: 1SKH
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Major prion protein 2 | A | 30 | Bos Taurus | MVKSKIGSWILVLFVAMWSDVGLCKKRPKP |
Method: SOLUTION NMR
Deposited Date: 2004-03-05 Deposition Author(s): Andersson, A. , Biverstahl, H. , Graslund, A. , Maler, L.