1SDS
Structure of protein l7ae bound to a k-turn derived from an archaeal box h/aca srna
PDB DOI: 10.2210/pdb1sds/pdb
Classification: protein/RNA complex Organism(s): Neobacillus Novalis , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2004-02-13 Deposition Author(s): Ferre-D'Amare, A. , Hamma, T.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.8 Å
Structure of protein l7ae bound to a k-turn derived from an archaeal box h/aca srna
Primary Citation of Related Structures: 1SDS
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| 50S ribosomal protein L7Ae | A | 117 | Neobacillus Novalis , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MAVYVKFKVPEEIQKELLDAVAKAQKIKKGANEVTKAVERGIAKLVIIAEDVKPEEVVAHLPYLCEEKGIPYAYVASKQDLGKAAGLEVAASSVAIINEGDAEELKVLIEKVNVLKQ |
| 50S ribosomal protein L7Ae | B | 117 | Neobacillus Novalis , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MAVYVKFKVPEEIQKELLDAVAKAQKIKKGANEVTKAVERGIAKLVIIAEDVKPEEVVAHLPYLCEEKGIPYAYVASKQDLGKAAGLEVAASSVAIINEGDAEELKVLIEKVNVLKQ |
| 50S ribosomal protein L7Ae | C | 117 | Neobacillus Novalis , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MAVYVKFKVPEEIQKELLDAVAKAQKIKKGANEVTKAVERGIAKLVIIAEDVKPEEVVAHLPYLCEEKGIPYAYVASKQDLGKAAGLEVAASSVAIINEGDAEELKVLIEKVNVLKQ |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2004-02-13 Deposition Author(s): Ferre-D'Amare, A. , Hamma, T.