Determination of the three-dimensional structure of scyllatoxin by 1h nuclear magnetic resonance
PDB DOI: 10.2210/pdb1scy/pdb
Classification: NEUROTOXIN Organism(s): Leiurus Quinquestriatus Hebraeus
Deposited: 1994-06-02 Deposition Author(s): Borremans, F.A.M. , Martins, J.C. , Van De Ven, F.J.M.
Determination of the three-dimensional structure of scyllatoxin by 1h nuclear magnetic resonance
Borremans, F.A.M. , Martins, J.C. , Van De Ven, F.J.M.
Primary Citation of Related Structures: 1SCY
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| SCYLLATOXIN | A | 32 | Leiurus Quinquestriatus Hebraeus | AFCNLRMCQLSCRSLGLLGKCIGDKCECVKHX |
Method: SOLUTION NMR
Deposited Date: 1994-06-02 Deposition Author(s): Borremans, F.A.M. , Martins, J.C. , Van De Ven, F.J.M.