An orally-bioavailable hiv-1 protease inhibitor containing an imidazole-derived peptide bond replacement. crystallographic and pharmacokinetic analysis
PDB DOI: 10.2210/pdb1sbg/pdb
Classification: HYDROLASE(ACID PROTEASE) Organism(s): Human Immunodeficiency Virus Type 1 Bh10
Deposited: 1994-05-24 Deposition Author(s): Abdel-Meguid, S. , Zhao, B.
An orally-bioavailable hiv-1 protease inhibitor containing an imidazole-derived peptide bond replacement. crystallographic and pharmacokinetic analysis
Primary Citation of Related Structures: 1SBG
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| HIV-1 PROTEASE | A | 99 | Human Immunodeficiency Virus Type 1 Bh10 | PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF |
| HIV-1 PROTEASE | B | 99 | Human Immunodeficiency Virus Type 1 Bh10 | PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF |
Method: X-RAY DIFFRACTION
Deposited Date: 1994-05-24 Deposition Author(s): Abdel-Meguid, S. , Zhao, B.