Crystal structure of lys49-phospholipase a2 from agkistrodon contortrix laticinctus, fatty acid bound form
PDB DOI: 10.2210/pdb1s8g/pdb
Classification: hydrolase, toxin Organism(s): Agkistrodon Contortrix Laticinctus
Deposited: 2004-02-02 Deposition Author(s): Ambrosio, A.L.B. , De Souza, D.H.F. , Garratt, R.C. , Nonato, M.C. , Ownby, C.L. , Selistre De Araujo, H.S.
Crystal structure of lys49-phospholipase a2 from agkistrodon contortrix laticinctus, fatty acid bound form
Ambrosio, A.L.B. , De Souza, D.H.F. , Garratt, R.C. , Nonato, M.C. , Ownby, C.L. , Selistre De Araujo, H.S.
Primary Citation of Related Structures: 1S8G
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Phospholipase A2 homolog | A | 121 | Agkistrodon Contortrix Laticinctus | SLLELGKMILQETGKNAITSYGSYGCNCGWGHRGQPKDATDRCCFVHKCCYKKLTDCNHKTDRYSYSWKNKAIICEEKNPCLKEMCECDKAVAICLRENLDTYNKKYKAYFKFKCKKPETC |
Method: X-RAY DIFFRACTION
Deposited Date: 2004-02-02 Deposition Author(s): Ambrosio, A.L.B. , De Souza, D.H.F. , Garratt, R.C. , Nonato, M.C. , Ownby, C.L. , Selistre De Araujo, H.S.